Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89016317

BLM, Mouse, Clone: 1E4, Abnova™

Catalog No. 89016317 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-317 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-317 Supplier Abnova Corporation Supplier No. H00000641M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant BLM.

The Bloom syndrome gene product is related to the RecQ subset of DExH box-containing DNA helicases and has both DNA-stimulated ATPase and ATP-dependent DNA helicase activities. Mutations causing Bloom syndrome delete or alter helicase motifs and may disable the 3'-5' helicase activity. The normal protein may act to suppress inappropriate recombination. [provided by RefSeq]

Sequence: SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS

Specifications

Antigen BLM
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1E4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BLM.
Formulation PBS with no preservative; pH 7.4
Gene BLM
Gene Accession No. NM_000057
Gene Alias BS/MGC126616/MGC131618/MGC131620/RECQ2/RECQL2/RECQL3
Gene Symbols BLM
Host Species Mouse
Immunogen BLM (NP_000048, 1196 a.a. ∼ 1295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 641
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.