Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

biliverdin reductase B (flavin reductase (NADPH)), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BLVRB.

Manufacturer:  Abnova Corporation H00000645A01

Catalog No. 89-004-034


Add to cart

Description

Description

The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC 1.3.1.24).[supplied by OMIM

Sequence: VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
Specifications

Specifications

biliverdin reductase B (flavin reductase (NADPH))
Unconjugated
50% glycerol
NM_000713
BVRB|FLR|MGC117413|SDR43U1
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
645
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant BLVRB.
BLVRB
Serum
BLVRB
BLVRB (NP_000704, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit