Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004035

bone morphogenetic protein 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004035 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-035 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-035 Supplier Abnova Corporation Supplier No. H00000649A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant BMP1.

This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region. [provided by RefSeq

Sequence: CDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLRFYSDN

Specifications

Antigen bone morphogenetic protein 1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant BMP1.
Formulation 50% glycerol
Gene BMP1
Gene Accession No. NM_006129
Gene Alias FLJ44432/PCOLC/PCP/TLD/pCP-2
Gene Symbols BMP1
Host Species Mouse
Immunogen BMP1 (NP_006120, 747 a.a. ∼ 845 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Cytokines
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 649
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.