BMP8B, Mouse, Clone: 6D6, Abnova™

Catalog No.	Quantity
89-016-347	200 μL

Catalog No. 89-016-347 Supplier Abnova Corporation Supplier No. H00000656M01A

Description

Mouse monoclonal antibody raised against a partial recombinant BMP8B.

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity. [provided by RefSeq

Sequence: KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV

Specifications

• Antigen: BMP8B
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6D6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BMP8B.
• Formulation: ascites with no preservative
• Gene: BMP8B
• Gene Accession No.: NM_001720
• Gene Alias: BMP8/MGC131757/OP2
• Gene Symbols: BMP8B
• Host Species: Mouse
• Immunogen: BMP8B (NP_001711, 274 a.a. ∼ 362 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 656
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ