Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BMP8B, Mouse, Clone: 6D6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant BMP8B.

Manufacturer:  Abnova Corporation H00000656M01A

Catalog No. 89-016-347


  Check Availability
Add to cart

Specifications

Description

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity. [provided by RefSeq

Sequence: KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV
Description & Specifications

Specifications

BMP8B
6D6
Human
Ascites
BMP8B
BMP8, MGC131757, OP2
Murine
IgG2a, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
bone morphogenetic protein 8b
In ascites fluid
NM_001720
BMP8B
BMP8B (NP_001711, 274 a.a. ∽363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
200μL
Human
Primary
656
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit