BMP8B, Mouse, Clone: 6D6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant BMP8B.

Manufacturer: Abnova Corporation H00000656M01A

Catalog No. 89-016-347

  Check Availability
Add to Cart

    Specifications

    Antigen BMP8B
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 6D6
    Conjugate Unlabeled
    Cross Reactivity Human
    Description bone morphogenetic protein 8b
    Format Ascites
    Formulation In ascites fluid
    Gene BMP8B
    Gene Accession No. NM_001720
    Gene Alias BMP8, MGC131757, OP2
    Gene Symbols BMP8B
    Host Species Mouse
    Immunogen BMP8B (NP_001711, 274 a.a. ∽363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG2a, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 656

    The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity. [provided by RefSeq

    Sequence: KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit