BMPR1B, Mouse, Clone: 2E2, Abnova™

Catalog No.	Quantity
89-016-348	100 μg

Catalog No. 89-016-348 Supplier Abnova Corporation Supplier No. H00000658M07

Description

Mouse monoclonal antibody raised against a partial recombinant BMPR1B.

This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs, which are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55kDa and type II receptors of about 70-80kDa. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in this gene have been associated with primary pulmonary hypertension. [provided by RefSeq

Sequence: TPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRA

Specifications

• Antigen: BMPR1B
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BMPR1B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BMPR1B
• Gene Accession No.: BC047773
• Gene Alias: ALK-6/ALK6/CDw293
• Gene Symbols: BMPR1B
• Host Species: Mouse
• Immunogen: BMPR1B (AAH47773.1, 24 a.a. ∼ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 658
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ