BNIP1, Mouse, Clone: 1G7, Abnova™

Catalog No.	Quantity
89-016-353	100 μg

Catalog No. 89-016-353 Supplier Abnova Corporation Supplier No. H00000662M01

Description

Mouse monoclonal antibody raised against a full-length recombinant BNIP1.

This gene is a member of the BCL2/adenovirus E1B 19kDa-interacting protein (BNIP) family. It interacts with the E1B 19kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq

Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL

Specifications

• Antigen: BNIP1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1G7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant BNIP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BNIP1
• Gene Accession No.: BC010959
• Gene Alias: NIP1/SEC20/TRG-8
• Gene Symbols: BNIP1
• Host Species: Mouse
• Immunogen: BNIP1 (AAH10959, 1 a.a. ∼ 228 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 662
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ