Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BNIP1, Mouse, Clone: 1G7, Abnova™

Catalog No. 89016353 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-353 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-353 Supplier Abnova Corporation Supplier No. H00000662M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant BNIP1.

This gene is a member of the BCL2/adenovirus E1B 19kDa-interacting protein (BNIP) family. It interacts with the E1B 19kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq

Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL

Specifications

Antigen BNIP1
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1G7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant BNIP1.
Formulation PBS with no preservative; pH 7.4
Gene BNIP1
Gene Accession No. BC010959
Gene Alias NIP1/SEC20/TRG-8
Gene Symbols BNIP1
Host Species Mouse
Immunogen BNIP1 (AAH10959, 1 a.a. ∼ 228 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 662
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.