Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BNIP3L, Mouse, Clone: 3G2, Abnova™

Catalog No. 89016354 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-354 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-354 Supplier Abnova Corporation Supplier No. H00000665M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant BNIP3L.

This gene is a member of the BCL2/adenovirus E1B 19kDa-interacting protein (BNIP) family. It interacts with the E1B 19kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19kDa-like sequences of BCL2, also an apoptotic protector. The protein encoded by this gene is a functional homolog of BNIP3, a proapoptotic protein. This protein may function simultaneously with BNIP3 and may play a role in tumor suppression. [provided by RefSeq

Sequence: SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE

Specifications

Antigen BNIP3L
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 3G2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BNIP3L.
Formulation PBS with no preservative; pH 7.4
Gene BNIP3L
Gene Accession No. NM_004331
Gene Alias BNIP3a/NIX
Gene Symbols BNIP3L
Host Species Mouse
Immunogen BNIP3L (NP_004322, 43 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 665
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.