BNIP3L, Mouse, Clone: 3G2, Abnova™

Catalog No.	Quantity
89-016-354	100 μg

Catalog No. 89-016-354 Supplier Abnova Corporation Supplier No. H00000665M01

Description

Mouse monoclonal antibody raised against a partial recombinant BNIP3L.

This gene is a member of the BCL2/adenovirus E1B 19kDa-interacting protein (BNIP) family. It interacts with the E1B 19kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19kDa-like sequences of BCL2, also an apoptotic protector. The protein encoded by this gene is a functional homolog of BNIP3, a proapoptotic protein. This protein may function simultaneously with BNIP3 and may play a role in tumor suppression. [provided by RefSeq

Sequence: SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE

Specifications

• Antigen: BNIP3L
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3G2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BNIP3L.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BNIP3L
• Gene Accession No.: NM_004331
• Gene Alias: BNIP3a/NIX
• Gene Symbols: BNIP3L
• Host Species: Mouse
• Immunogen: BNIP3L (NP_004322, 43 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 665
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ