Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BRAF, Mouse, Clone: 1H7, Abnova™

Catalog No. 89016364 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-364 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-364 Supplier Abnova Corporation Supplier No. H00000673M10
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant BRAF.

This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, nonsmall cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene. [provided by RefSeq

Sequence: FQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVP

Specifications

Antigen BRAF
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1H7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BRAF.
Formulation PBS with no preservative; pH 7.4
Gene BRAF
Gene Accession No. NM_004333
Gene Alias B-RAF1/BRAF1/FLJ95109/MGC126806/MGC138284/RAFB1
Gene Symbols BRAF
Host Species Mouse
Immunogen BRAF (NP_004324, 138 a.a. ∼ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 673
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.