BRAF, Mouse, Clone: 2F6, Abnova™

Catalog No.	Quantity
89-016-365	100 μg

Catalog No. 89-016-365 Supplier Abnova Corporation Supplier No. H00000673M11

Description

Mouse monoclonal antibody raised against a partial recombinant BRAF.

This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, nonsmall cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene. [provided by RefSeq

Sequence: FQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVP

Specifications

• Antigen: BRAF
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2F6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BRAF.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BRAF
• Gene Accession No.: NM_004333
• Gene Alias: B-RAF1/BRAF1/FLJ95109/MGC126806/MGC138284/RAFB1
• Gene Symbols: BRAF
• Host Species: Mouse
• Immunogen: BRAF (NP_004324, 138 a.a. ∼ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 673
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ