Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BRF2.

Manufacturer:  Abnova Corporation H00055290A01

Catalog No. 89-004-660


Add to cart

Description

Description

This gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with the TATA-binding protein. [provided by RefSeq

Sequence: MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQA
Specifications

Specifications

BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like
Unconjugated
50% glycerol
NM_018310
BRFU|FLJ11052|TFIIIB50
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
55290
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant BRF2.
BRF2
Serum
BRF2
BRF2 (NP_060780, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit