BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BRF2.

Supplier:  Abnova Corporation H00055290A01

Catalog No. 89-004-660

Description

This gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with the TATA-binding protein. [provided by RefSeq

Sequence: MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQA

Specifications

• Antigen: BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant BRF2.
• Gene: BRF2
• Gene Alias: BRFU/FLJ11052/TFIIIB50
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 55290
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_018310
• Gene Symbols: BRF2
• Immunogen: BRF2 (NP_060780, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum