BSCL2 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-142	50 μL

Catalog No. 89-003-142 Supplier Abnova Corporation Supplier No. H00026580A01

Description

Mouse polyclonal antibody raised against a partial recombinant BSCL2.

This gene encodes protein seipin, which is located in the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: WGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAAL

Specifications

• Antigen: BSCL2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant BSCL2.
• Formulation: 50% glycerol
• Gene: BSCL2
• Gene Accession No.: NM_032667
• Gene Alias: GNG3LG/HMN5/MGC4694/SPG17
• Gene Symbols: BSCL2
• Host Species: Mouse
• Immunogen: BSCL2 (NP_116056, 259 a.a. ∼ 357 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 26580
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid