BTB (POZ) domain containing 1, Mouse, Clone: 3E11, Abnova™

Catalog No.	Quantity
89-014-313	100 μg

Catalog No. 89-014-313 Supplier Abnova Corporation Supplier No. H00053339M01

Description

Mouse monoclonal antibody raised against a partial recombinant BTBD1.

The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: EYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT

Specifications

• Antigen: BTB (POZ) domain containing 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BTBD1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BTBD1
• Gene Accession No.: NM_025238
• Gene Alias: C15orf1/NS5ATP8
• Gene Symbols: BTBD1
• Host Species: Mouse
• Immunogen: BTBD1 (NP_079514, 384 a.a. ∼ 482 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 53339
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ