Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89018054

betacellulin, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89018054 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-018-054 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-018-054 Supplier Abnova Corporation Supplier No. H00000685D01P
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against a full-length human BTC protein.

The protein encoded by this gene is a member of the EGF family of growth factors. It is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. [provided by RefSeq

Sequence: MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Specifications

Antigen betacellulin
Applications In situ PLA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human BTC protein.
Formulation PBS with no preservative; pH 7.4
Gene BTC
Gene Accession No. NM_001729
Gene Symbols BTC
Host Species Rabbit
Immunogen BTC (NP_001720.1, 1 a.a. ∼ 178 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Primary or Secondary Primary
Gene ID (Entrez) 685
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.