Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001067

BTG family, member 2, Mouse, Clone: 1A5, Abnova™

Catalog No. 89001067 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-067 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-067 Supplier Abnova Corporation Supplier No. H00007832M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant BTG2.

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. [provided by RefSeq

Sequence: PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS

Specifications

Antigen BTG family, member 2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1A5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BTG2.
Formulation PBS with no preservative; pH 7.4
Gene BTG2
Gene Accession No. NM_006763
Gene Alias MGC126063/MGC126064/PC3/TIS21
Gene Symbols BTG2
Host Species Mouse
Immunogen BTG2 (NP_006754, 59 a.a. ∼ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 7832
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.