Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001402

B and T lymphocyte associated, Mouse, Clone: 1B7, Abnova™

Catalog No. 89001402 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-402 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-402 Supplier Abnova Corporation Supplier No. H00151888M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant BTLA.

BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 (MIM 600244) and CTLA4 (MIM 123890), BTLA interacts with a B7 homolog, B7H4.[supplied by OMIM

Sequence: DTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS

Specifications

Antigen B and T lymphocyte associated
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1B7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BTLA.
Formulation PBS with no preservative; pH 7.4
Gene BTLA
Gene Accession No. NM_181780
Gene Alias BTLA1/CD272/FLJ16065/MGC129743
Gene Symbols BTLA
Host Species Mouse
Immunogen BTLA (NP_861445, 190 a.a. ∼ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Membrane Receptors
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 151888
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.