Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000549

budding uninhibited by benzimidazoles 1 homolog (yeast), Mouse, Clone: 2F9, Abnova™

Catalog No. 89000549 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-549 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-549 Supplier Abnova Corporation Supplier No. H00000699M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant BUB1.

This gene encodes a kinase involved in spindle checkpoint function. The kinase functions in part by phosphorylating a member of the miotic checkpoint complex and activating the spindle checkpoint. Mutations in this gene have been associated with aneuploidy and several forms of cancer. [provided by RefSeq

Sequence: MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA

Specifications

Antigen budding uninhibited by benzimidazoles 1 homolog (yeast)
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 2F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BUB1.
Formulation PBS with no preservative; pH 7.4
Gene BUB1
Gene Accession No. BC028201
Gene Alias BUB1A/BUB1L/hBUB1
Gene Symbols BUB1
Host Species Mouse
Immunogen BUB1 (AAH28201, 1 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 699
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.