Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014277

blood vessel epicardial substance, Mouse, Clone: 3F7, Abnova™

Catalog No. 89014277 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-277 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-277 Supplier Abnova Corporation Supplier No. H00011149M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant BVES.

This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in development of these tissues. The mouse ortholog may be involved in the regeneration of adult skeletal muscle and may act as a cell adhesion molecule in coronary vasculogenesis. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: YSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP

Specifications

Antigen blood vessel epicardial substance
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3F7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BVES.
Formulation PBS with no preservative; pH 7.4
Gene BVES
Gene Accession No. NM_007073
Gene Alias HBVES/MGC42413/POP1/POPDC1
Gene Symbols BVES
Host Species Mouse
Immunogen BVES (NP_009004, 262 a.a. ∼ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11149
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.