Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89003233

BZRP, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89003233 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-003-233 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-003-233 Supplier Abnova Corporation Supplier No. H00000706A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length recombinant BZRP.

Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE

Specifications

Antigen BZRP
Applications ELISA
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length recombinant BZRP.
Formulation 50% glycerol
Gene TSPO
Gene Accession No. BC001110
Gene Alias BZRP/DBI/IBP/MBR/PBR/PKBS/PTBR/mDRC/pk18
Gene Symbols TSPO
Host Species Mouse
Immunogen BZRP (AAH01110.1, 1 a.a. ∼ 169 a.a) full-length recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 706
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.