anti-c-Myc-responsive protein Rcl, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP185181

Catalog No. NBP185181

Description

c-Myc-responsive protein Rcl Polyclonal antibody specifically detects c-Myc-responsive protein Rcl in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: c-Myc-responsive protein Rcl
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: chromosome 6 open reading frame 108, c-Myc-responsive protein Rcl, deoxyribonucleoside 5'-monophosphate N-glycosidase, dJ330M21.3, EC 3.2.2, EC 3.2.2.-, putative c-Myc-responsive, rcl, RP3-330M21.3
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 0.1 ml
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20
• Format: Affinity Purified
• Gene Symbols: DNPH1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHV
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10591
• Target Species: Human

For Research Use Only