Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

chromosome 10 open reading frame 46, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant C10orf46.

Manufacturer:  Abnova Corporation H00143384A01

Catalog No. 89-004-795


Add to cart

Description

Description

Sequence: STININTSTSKFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMYSDLIKKITNHLERVSKELQASPPDLYIERF
Specifications

Specifications

chromosome 10 open reading frame 46
Unconjugated
50% glycerol
NM_153810
FLJ40409|MGC33215
Mouse
50 uL
Cell Cycle
Y
Polyclonal
Human, Murine, Rat
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant C10orf46.
C10orf46
Serum
C10orf46
C10orf46 (NP_722517, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
143384
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit