core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant C1GALT1.

Supplier:  Abnova Corporation H00056913A01

Catalog No. 89-004-687

Description

The common core 1 O-glycan structure Gal-beta-1-3GalNAc-R is a precursor for many extended mucin-type O-glycan structures in animal cell surface and secreted glycoproteins. Core 1 is synthesized by the transfer of Gal from UDP-Gal to GalNAc-alpha-1-R by core 1 beta-3-galactosyltransferase (C1GALT1) (Ju et al., 2002 [PubMed 11677243]).[supplied by OMIM

Sequence: ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP

Specifications

• Antigen: core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant C1GALT1.
• Gene: C1GALT1
• Gene Alias: C1GALT/T-synthase
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Angiogenesis
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_020156
• Gene Symbols: C1GALT1
• Immunogen: C1GALT1 (NP_064541, 264 a.a. ∼ 363 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 56913
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.