tRNA splicing endonuclease 15 homolog (S. cerevisiae), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human C1orf19 protein.

Supplier:  Abnova Corporation H00116461D01P

Catalog No. 89-018-661

Description

tRNA splicing is a fundamental process required for cell growth and division. SEN15 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]).[supplied by OMIM

Sequence: MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR

Specifications

• Antigen: tRNA splicing endonuclease 15 homolog (S. cerevisiae)
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human C1orf19 protein.
• Gene: TSEN15
• Gene Alias: C1orf19/sen15
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 116461
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_052965.1
• Gene Symbols: TSEN15
• Immunogen: C1orf19 (NP_443197.1, 1 a.a. ∼ 171 a.a) full-length human protein.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody