Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004036

complement component 1, q subcomponent binding protein, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004036 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-036 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-036 Supplier Abnova Corporation Supplier No. H00000708A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant C1QBP.

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq

Sequence: IKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Specifications

Antigen complement component 1, q subcomponent binding protein
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant C1QBP.
Formulation 50% glycerol
Gene C1QBP
Gene Accession No. NM_001212
Gene Alias GC1QBP/HABP1/SF2p32/gC1Q-R/gC1qR/p32
Gene Symbols C1QBP
Host Species Mouse
Immunogen C1QBP (NP_001203, 173 a.a. ∼ 282 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Stem Cell Biology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 708
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.