C4B, Mouse, Clone: 2E3, Abnova™

Catalog No.	Quantity
89-016-379	100 μg

Catalog No. 89-016-379 Supplier Abnova Corporation Supplier No. H00000721M01

Description

Mouse monoclonal antibody raised against a partial recombinant C4B.

This gene encodes the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4kb endogenous HERV-K retrovirus in intron 9. [provided by RefSeq

Sequence: NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG

Specifications

• Antigen: C4B
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant C4B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: C4B
• Gene Accession No.: NM_000592
• Gene Alias: C4A/C4A13/C4A91/C4B1/C4B12/C4B2/C4B3/C4B5/C4F/CH/CO4/CPAMD3/FLJ60561/MGC164979
• Gene Symbols: C4B
• Host Species: Mouse
• Immunogen: C4B (NP_000583, 1347 a.a. ∼ 1446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 721
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ