carbonic anhydrase X, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-007-952	50 μL

Catalog No. 89-007-952 Supplier Abnova Corporation Supplier No. H00056934B01

Description

Mouse polyclonal antibody raised against a full-length human CA10 protein.

This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK

Specifications

• Antigen: carbonic anhydrase X
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human CA10 protein.
• Formulation: No additive
• Gene: CA10
• Gene Accession No.: NM_020178.3
• Gene Alias: CA-RPX/CARPX/HUCEP-15
• Gene Symbols: CA10
• Host Species: Mouse
• Immunogen: CA10 (NP_064563.1, 1 a.a. ∼ 328 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 56934
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum