carbonic anhydrase XII, Mouse, Clone: 1D4, Abnova™

Catalog No.	Quantity
89-014-064	100 μg

Catalog No. 89-014-064 Supplier Abnova Corporation Supplier No. H00000771M01

Description

Mouse monoclonal antibody raised against a partial recombinant CA12.

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN

Specifications

• Antigen: carbonic anhydrase XII
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 1D4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CA12.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CA12
• Gene Accession No.: NM_206925
• Gene Alias: CAXII/FLJ20151/HsT18816
• Gene Symbols: CA12
• Host Species: Mouse
• Immunogen: CA12 (NP_996808, 25 a.a. ∼ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Endocrine/Metabolism
• Primary or Secondary: Primary
• Gene ID (Entrez): 771
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ