CA3, Mouse, Clone: 4A12-1A3, Abnova™

Catalog No.	Quantity
89-016-396	100 μg

Catalog No. 89-016-396 Supplier Abnova Corporation Supplier No. H00000761M02

Description

Mouse monoclonal antibody raised against a full-length recombinant CA3.

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3kb and contains seven exons and six introns. [provided by RefSeq

Sequence: MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK

Specifications

• Antigen: CA3
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4A12-1A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant CA3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CA3
• Gene Accession No.: BC004897
• Gene Alias: CAIII/Car3
• Gene Symbols: CA3
• Host Species: Mouse
• Immunogen: CA3 (AAH04897, 1 a.a. ∼ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 761
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ