carbonic anhydrase III, muscle specific, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-463	100 μg

Catalog No. 89-017-463 Supplier Abnova Corporation Supplier No. H00000761D01P

Description

Rabbit polyclonal antibody raised against a full-length human CA3 protein.

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3kb and contains seven exons and six introns. [provided by RefSeq

Sequence: MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Specifications

• Antigen: carbonic anhydrase III, muscle specific
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human CA3 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CA3
• Gene Accession No.: NM_005181
• Gene Alias: CAIII/Car3
• Gene Symbols: CA3
• Host Species: Rabbit
• Immunogen: CA3 (NP_005172.1, 1 a.a. ∼ 260 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Endocrine/Metabolism
• Primary or Secondary: Primary
• Gene ID (Entrez): 761
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG