Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

chaperone, ABC1 activity of bc1 complex homolog (S. pombe), Mouse, Clone: 1C12, Abnova™

Catalog No. 89001545 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-545 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-545 Supplier Abnova Corporation Supplier No. H00056997M01A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CABC1.

This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined. [provided by RefSeq

Sequence: MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD

Specifications

Antigen chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1C12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CABC1.
Formulation ascites with no preservative
Gene CABC1
Gene Accession No. BC005171
Gene Alias ADCK3/ARCA2/COQ8/MGC4849/SCAR9
Gene Symbols CABC1
Host Species Mouse
Immunogen CABC1 (AAH05171, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 56997
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.