chaperone, ABC1 activity of bc1 complex homolog (S. pombe), Mouse, Clone: 1C12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CABC1.

Supplier:  Abnova Corporation H00056997M01A

Catalog No. 89-001-545

Description

This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined. [provided by RefSeq

Sequence: MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD

Specifications

• Antigen: chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC005171
• Gene Symbols: CABC1
• Immunogen: CABC1 (AAH05171, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 56997
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 1C12
• Description: Mouse monoclonal antibody raised against a partial recombinant CABC1.
• Gene: CABC1
• Gene Alias: ADCK3/ARCA2/COQ8/MGC4849/SCAR9
• Host Species: Mouse
• Quantity: 200 μL
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ