Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CACNA1F (M01J), Mouse anti-Human, Clone: 3B2, Abnova™

Catalog No. 89016400 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-400 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-400 Supplier Abnova Corporation Supplier No. H00000778M01J
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CACNA1F.

This gene encodes a member of the alpha-1 subunit family; a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants of the gene described here have been observed but have not been thoroughly characterized. Mutations in this gene have been shown to cause incomplete X-linked congential stationary night blindness type 2 (CSNB2). [provided by RefSeq

Sequence: LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL

Specifications

Antigen CACNA1F
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3B2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CACNA1F.
Formulation PBS with no preservative; pH 7.4
Gene CACNA1F
Gene Accession No. NM_005183
Gene Alias AIED/COD3/CORDX/CORDX3/CSNB2/CSNB2A/CSNBX2/Cav1.4/JM8/JMC8/OA2
Gene Symbols CACNA1F
Host Species Mouse
Immunogen CACNA1F (NP_005174, 1878 a.a. ∼ 1977 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 778
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.