CACNA1F, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-235	50 μL

Catalog No. 89-003-235 Supplier Abnova Corporation Supplier No. H00000778A01

Description

Mouse polyclonal antibody raised against a partial recombinant CACNA1F.

This gene encodes a member of the alpha-1 subunit family; a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants of the gene described here have been observed but have not been thoroughly characterized. Mutations in this gene have been shown to cause incomplete X-linked congential stationary night blindness type 2 (CSNB2). [provided by RefSeq

Sequence: LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL

Specifications

• Antigen: CACNA1F
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CACNA1F.
• Formulation: 50% glycerol
• Gene: CACNA1F
• Gene Accession No.: NM_005183
• Gene Alias: AIED/COD3/CORDX/CORDX3/CSNB2/CSNB2A/CSNBX2/Cav1.4/JM8/JMC8/OA2
• Gene Symbols: CACNA1F
• Host Species: Mouse
• Immunogen: CACNA1F (NP_005174, 1878 a.a. ∼ 1977 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 778
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid