Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CACNA1F, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CACNA1F.

Manufacturer:  Abnova Corporation H00000778A01

Catalog No. 89-003-235


Add to cart

Description

Description

This gene encodes a member of the alpha-1 subunit family; a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants of the gene described here have been observed but have not been thoroughly characterized. Mutations in this gene have been shown to cause incomplete X-linked congential stationary night blindness type 2 (CSNB2). [provided by RefSeq

Sequence: LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
Specifications

Specifications

CACNA1F
Unconjugated
50% glycerol
NM_005183
AIED|COD3|CORDX|CORDX3|CSNB2|CSNB2A|CSNBX2|Cav1.4|JM8|JMC8|OA2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CACNA1F.
CACNA1F
Liquid
CACNA1F
CACNA1F (NP_005174, 1878 a.a. ~ 1977 a.a) partial recombinant protein with GST tag.
RUO
Primary
778
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit