calcium channel, voltage-dependent, beta 2 subunit, Mouse, Clone: 6C4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CACNB2.

Supplier:  Abnova Corporation H00000783M05

Catalog No. 89-000-552

Description

Sequence: PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ

Specifications

• Antigen: calcium channel, voltage-dependent, beta 2 subunit
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_201596
• Gene Symbols: CACNB2
• Immunogen: CACNB2 (NP_963890, 213 a.a. ∼ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 783
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ

• Applications: ELISA, Western Blot
• Clone: 6C4
• Description: Mouse monoclonal antibody raised against a partial recombinant CACNB2.
• Gene: CACNB2
• Gene Alias: CACNLB2/CAVB2/FLJ23743/MYSB
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody