calcium binding and coiled-coil domain 2, Mouse, Clone: 2A11, Abnova™

Catalog No.	Quantity
89-001-170	100 μg

Catalog No. 89-001-170 Supplier Abnova Corporation Supplier No. H00010241M04

Description

Mouse monoclonal antibody raised against a partial recombinant CALCOCO2.

The protein encoded by this gene is a subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles. [provided by RefSeq

Sequence: SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL

Specifications

• Antigen: calcium binding and coiled-coil domain 2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2A11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CALCOCO2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CALCOCO2
• Gene Accession No.: NM_005831
• Gene Alias: MGC17318/NDP52
• Gene Symbols: CALCOCO2
• Host Species: Mouse
• Immunogen: CALCOCO2 (NP_005822, 347 a.a. ∼ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10241
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ