Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CALML3, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CALML3 protein.

Manufacturer:  Abnova Corporation H00000810D01

Catalog No. 89-002-880


Add to cart

Description

Description

Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Specifications

Specifications

CALML3
Unconjugated
No additive
NM_005185.2
CLP
Rabbit
100 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunoprecipitation, Western Blot
Rabbit polyclonal antibody raised against a full-length human CALML3 protein.
CALML3
Liquid
CALML3
CALML3 (NP_005176.1, 1 a.a. ~ 149 a.a) full-length human protein.
RUO
Primary
810
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit