Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CALML6, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CALML6 protein.

Manufacturer:  Abnova Corporation H00163688D01P

Catalog No. 89-003-210


Add to cart

Description

Description

Sequence: MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ
Specifications

Specifications

CALML6
Unconjugated
In 1X PBS, pH 7.4
BC160060.1
CAGLP
Rabbit
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunofluorescence, Western Blot
Rabbit polyclonal antibody raised against a full-length human CALML6 protein.
CALML6
Purified
CALML6
CALML6 (AAI60060.1, 1 a.a. ~ 181 a.a) full-length human protein.
RUO
Primary
163688
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit