Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001087

calcium/calmodulin-dependent protein kinase I, Mouse, Clone: 2B6, Abnova™

Catalog No. 89001087 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-087 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-087 Supplier Abnova Corporation Supplier No. H00008536M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CAMK1.

Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. [provided by RefSeq

Sequence: LQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGTELSPTLPHQL

Specifications

Antigen calcium/calmodulin-dependent protein kinase I
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2B6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CAMK1.
Formulation PBS with no preservative; pH 7.4
Gene CAMK1
Gene Accession No. NM_003656
Gene Alias CAMKI/MGC120317/MGC120318
Gene Symbols CAMK1
Host Species Mouse
Immunogen CAMK1 (NP_003647, 271 a.a. ∼ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 8536
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.