CAMK2A, Mouse, Clone: 2C4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CAMK2A.

Supplier:  Abnova Corporation H00000815M01

Catalog No. 89-016-414

Description

The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV

Specifications

• Antigen: CAMK2A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC040457
• Gene Symbols: CAMK2A
• Immunogen: CAMK2A (AAH40457, 305 a.a. ∼ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 2C4
• Description: Mouse monoclonal antibody raised against a partial recombinant CAMK2A.
• Gene: CAMK2A
• Gene Alias: CAMKA/KIAA0968
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 815
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid