cullin-associated and neddylation-dissociated 1, Mouse, Clone: 5F2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CAND1.

Supplier:  Abnova Corporation H00055832M02

Catalog No. 89-001-311

Description

Sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE

Specifications

• Antigen: cullin-associated and neddylation-dissociated 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_018448
• Gene Symbols: CAND1
• Immunogen: CAND1 (NP_060918, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 5F2
• Description: Mouse monoclonal antibody raised against a partial recombinant CAND1.
• Gene: CAND1
• Gene Alias: DKFZp434M1414/FLJ10114/FLJ10929/FLJ38691/FLJ90441/KIAA0829/TIP120/TIP120A
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 55832
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG3 κ