CAPN3, Mouse, Clone: 1B2, Abnova™

Catalog No.	Quantity
89-016-425	100 μg

Catalog No. 89-016-425 Supplier Abnova Corporation Supplier No. H00000825M01

Description

Mouse monoclonal antibody raised against a partial recombinant CAPN3.

Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed. [provided by RefSeq

Sequence: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA

Specifications

• Antigen: CAPN3
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1B2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CAPN3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CAPN3
• Gene Accession No.: BC003169
• Gene Alias: CANP3/CANPL3/LGMD2/LGMD2A/MGC10767/MGC11121/MGC14344/MGC4403/nCL-1/p94
• Gene Symbols: CAPN3
• Host Species: Mouse
• Immunogen: CAPN3 (AAH03169.1, 210 a.a. ∼ 309 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 825
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ