CAPN5, Mouse, Clone: 3C10, Abnova™

Catalog No.	Quantity
89-016-383	200 μL

Catalog No. 89-016-383 Supplier Abnova Corporation Supplier No. H00000726M02A

Description

Mouse monoclonal antibody raised against a partial recombinant CAPN5.

Calpains are calcium-dependent cysteine proteases involved in signal transduction in a variety of cellular processes. A functional calpain protein consists of an invariant small subunit and 1 of a family of large subunits. CAPN5 is one of the large subunits. Unlike some of the calpains, CAPN5 and CAPN6 lack a calmodulin-like domain IV. Because of the significant similarity to Caenorhabditis elegans sex determination gene tra-3, CAPN5 is also called as HTRA3. [provided by RefSeq

Sequence: VLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNLQALHTLHLRDRNSRQPSN

Specifications

• Antigen: CAPN5
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3C10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CAPN5.
• Formulation: ascites with no preservative
• Gene: CAPN5
• Gene Accession No.: NM_004055
• Gene Alias: FLJ46245/HTRA3/nCL-3
• Gene Symbols: CAPN5
• Host Species: Mouse
• Immunogen: CAPN5 (NP_004046, 523 a.a. ∼ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 726
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ