calpain, small subunit 1, Mouse, Clone: 3C4, Abnova™

Catalog No.	Quantity
89-014-066	100 μg

Catalog No. 89-014-066 Supplier Abnova Corporation Supplier No. H00000826M01

Description

Mouse monoclonal antibody raised against a partial recombinant CAPNS1.

Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq

Sequence: KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE

Specifications

• Antigen: calpain, small subunit 1
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 3C4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CAPNS1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CAPNS1
• Gene Accession No.: BC000592
• Gene Alias: 30K/CALPAIN4/CANP/CANPS/CAPN4/CDPS
• Gene Symbols: CAPNS1
• Host Species: Mouse
• Immunogen: CAPNS1 (AAH00592, 172 a.a. ∼ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 826
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ