Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CAPS, Mouse, Clone: 4C6, Abnova™

Catalog No. 89016426 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-426 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-426 Supplier Abnova Corporation Supplier No. H00000828M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CAPS.

This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq

Sequence: MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSG

Specifications

Antigen CAPS
Applications ELISA, KnockDown, Western Blot
Classification Monoclonal
Clone 4C6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CAPS.
Formulation PBS with no preservative; pH 7.4
Gene CAPS
Gene Accession No. NM_004058
Gene Alias CAPS1/MGC126562
Gene Symbols CAPS
Host Species Mouse
Immunogen CAPS (NP_004049, 1 a.a. ∼ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 828
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.