Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

capping protein (actin filament) muscle Z-line, alpha 1 (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CAPZA1.

Manufacturer:  Abnova Corporation H00000829A02

Catalog No. 89-004-042


Add to cart

Description

Description

CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq

Sequence: LGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWN
Specifications

Specifications

capping protein (actin filament) muscle Z-line, alpha 1
Unconjugated
50% glycerol
NM_006135
CAPPA1|CAPZ|CAZ1
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
829
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CAPZA1.
CAPZA1
Serum
CAPZA1
CAPZA1 (NP_006126, 82 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit