capping protein (actin filament) muscle Z-line, alpha 1 (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CAPZA1.

Supplier:  Abnova Corporation H00000829A02

Catalog No. 89-004-042

Description

CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq

Sequence: LGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWN

Specifications

• Antigen: capping protein (actin filament) muscle Z-line, alpha 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant CAPZA1.
• Gene: CAPZA1
• Gene Alias: CAPPA1/CAPZ/CAZ1
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 829
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006135
• Gene Symbols: CAPZA1
• Immunogen: CAPZA1 (NP_006126, 82 a.a. ∼ 170 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum