Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004043

capping protein (actin filament) muscle Z-line, alpha 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004043 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-043 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-043 Supplier Abnova Corporation Supplier No. H00000830A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant CAPZA2.

The protein encoded by this gene is a member of the F-actin capping protein alpha subunit family. It is the alpha subunit of the barbed-end actin binding protein Cap Z. By capping the barbed end of actin filaments, Cap Z regulates the growth of the actin filaments at the barbed end. [provided by RefSeq

Sequence: CEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFW

Specifications

Antigen capping protein (actin filament) muscle Z-line, alpha 2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant CAPZA2.
Formulation 50% glycerol
Gene CAPZA2
Gene Accession No. NM_006136
Gene Alias CAPPA2/CAPZ
Gene Symbols CAPZA2
Host Species Mouse
Immunogen CAPZA2 (NP_006127, 111 a.a. ∼ 169 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 830
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.