Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CAPZB, Mouse, Clone: 4H8, Abnova™

Catalog No. 89016429 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-429 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-429 Supplier Abnova Corporation Supplier No. H00000832M03
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CAPZB.

CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq

Sequence: SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Specifications

Antigen CAPZB
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4H8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CAPZB.
Formulation PBS with no preservative; pH 7.4
Gene CAPZB
Gene Accession No. NM_004930
Gene Alias CAPB/CAPPB/CAPZ/MGC104401/MGC129749/MGC129750
Gene Symbols CAPZB
Host Species Mouse
Immunogen CAPZB (NP_004921, 192 a.a. ∼ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 832
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.