CASP10, Mouse, Clone: 2E7, Abnova™

Catalog No.	Quantity
89-016-433	100 μg

Catalog No. 89-016-433 Supplier Abnova Corporation Supplier No. H00000843M02

Description

Mouse monoclonal antibody raised against a partial recombinant CASP10.

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with apoptosis defects seen in type II autoimmune lymphoproliferative syndrome. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ

Specifications

• Antigen: CASP10
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2E7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CASP10.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CASP10
• Gene Accession No.: NM_032974
• Gene Alias: ALPS2/FLICE2/MCH4
• Gene Symbols: CASP10
• Host Species: Mouse
• Immunogen: CASP10 (NP_116756, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 843
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ