CASP2, Mouse, Clone: 1C11, Abnova™

Catalog No.	Quantity
89-016-430	100 μg

Catalog No. 89-016-430 Supplier Abnova Corporation Supplier No. H00000835M10

Description

Mouse monoclonal antibody raised against a partial recombinant CASP2.

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The proteolytic cleavage of this protein is induced by a variety of apoptotic stimuli. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. [provided by RefSeq

Sequence: TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRS

Specifications

• Antigen: CASP2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1C11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CASP2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CASP2
• Gene Accession No.: BC002427
• Gene Alias: CASP-2/ICH-1L/ICH-1L/1S/ICH1/NEDD2
• Gene Symbols: CASP2
• Host Species: Mouse
• Immunogen: CASP2 (AAH02427, 121 a.a. ∼ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 835
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ