caspase 2, apoptosis-related cysteine peptidase, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-044	50 μL

Catalog No. 89-004-044 Supplier Abnova Corporation Supplier No. H00000835A01

Description

Mouse polyclonal antibody raised against a partial recombinant CASP2.

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The proteolytic cleavage of this protein is induced by a variety of apoptotic stimuli. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. [provided by RefSeq

Sequence: TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRS

Specifications

• Antigen: caspase 2, apoptosis-related cysteine peptidase
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CASP2.
• Formulation: 50% glycerol
• Gene: CASP2
• Gene Accession No.: BC002427
• Gene Alias: CASP-2/ICH-1L/ICH-1L/1S/ICH1/NEDD2
• Gene Symbols: CASP2
• Host Species: Mouse
• Immunogen: CASP2 (AAH02427, 121 a.a. ∼ 220 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 835
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum