CASP7, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-002-881	100 μL

Catalog No. 89-002-881 Supplier Abnova Corporation Supplier No. H00000840D01

Description

Rabbit polyclonal antibody raised against a full-length human CASP7 protein.

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of this caspase is cleaved by caspase 3 and 10. It is activated upon cell death stimuli and induces apoptosis. Alternative splicing results in four transcript variants, encoding three distinct isoforms. [provided by RefSeq

Sequence: MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Specifications

• Antigen: CASP7
• Applications: Immunoprecipitation, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human CASP7 protein.
• Formulation: No additive
• Gene: CASP7
• Gene Accession No.: NM_001227
• Gene Alias: CMH-1/ICE-LAP3/MCH3
• Gene Symbols: CASP7
• Host Species: Rabbit
• Immunogen: CASP7 (NP_001218.1, 1 a.a. ∼ 303 a.a) full-length human protein.
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 840
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid