CAST, Mouse, Clone: 2C5, Abnova™

Catalog No.	Quantity
89-016-427	100 μg

Catalog No. 89-016-427 Supplier Abnova Corporation Supplier No. H00000831M03

Description

Mouse monoclonal antibody raised against a partial recombinant CAST.

The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length natures of only some have been determined. [provided by RefSeq

Sequence: QPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQ

Specifications

• Antigen: CAST
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2C5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CAST.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CAST
• Gene Accession No.: NM_001750
• Gene Alias: BS-17/MGC9402
• Gene Symbols: CAST
• Host Species: Mouse
• Immunogen: CAST (NP_001741.3, 582 a.a. ∼ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 831
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ